Arhgap19, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arhgap19, Each
$ 1,757.70
|
|
Details
Members of the arhgap family, such as arhgap19, encode negative regulators of rho gtpases (see rhoa; mim 165390), which are involved in cell migration, proliferation, and differentiation, actin remodeling, and g1 cell cycle progression (lv et al., 2007 [Pubmed 17454002]).[Supplied by omimsequence: llthkhfnahlkiadlmqfddkgnktnipdkdrqiealqllflilpppnrnllkllldllyqtakkqdknkmsaynlalmf
Additional Information
| SKU | 10289880 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24023 |
