518-831-8000 sales@utechproducts.com

Arap2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arap2, Each

1,757.70

Details

The protein encoded by this gene contains arf-gap, rho-gap, ankyrin repeat, ras-associating, and pleckstrin homology domains. The protein is a phosphatidylinositol (3,4,5)-trisphosphate-dependent arf6 gap that binds rhoa-gtp, but it lacks the predicted catalytic arginine in the rho-gap domain and does not have rho-gap activity. The protein associates with focal adhesions and functions downstream of rhoa to regulate focal adhesion dynamics. [Provided by refseqsequence: hclehkddklrnrprkhrsfncledtepeaplgqpkghkglktlrktedrnskatldsdhklpsrvieelnvvlqrsrtlpkelqdeqi

Additional Information

SKU 10288920
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22927