Apoa4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Apoa4, Each
$ 1,757.70
|
|
Details
Apoliprotein (apo) a-iv gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'utr of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo a-iv is a potent activator of lecithin-cholesterol acyltransferase in vitro. [Provided by refseqsequence: legltfqmkknaeelkarisasaeelrqrlaplaedvrgnlrgnteglqkslaelgghldqqveefrrrvepygenfnkalvqqmeqlrqklgphagdveghlsflekdlrdkvnsffstfkekesqdktlslp
Additional Information
| SKU | 10292302 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28418 |
