Aplp1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Aplp1, Each
$ 1,757.70
|
|
Details
This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta a4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. [Provided by refseqsequence: gtavgdpstrswppgsrvegaedeeeeesfpqpvddyfveppqaeeeeetvpppsshtlavvgkvtptprptdgvdiyfgmpgeisehegflrakmdleerrmrqinevmrewamadnqsk
Additional Information
| SKU | 10288327 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22231 |
