Ap4s1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ap4s1, Each
$ 1,757.70
|
|
Details
The heterotetrameric adaptor protein (ap) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. Ap4 is composed of 2 large chains, beta-4 (ap4b1; mim 607245) and epsilon-4 (ap4e1; mim 607244), a medium chain, mu-4 (ap4m1; mim 602296), and a small chain, sigma-4 (ap4s1).[Supplied by omimsequence: ldeyfsrvseldvsffntvfhstwqmhsgpyqepidelpkicsalepqqtcfspdsssfkgaastt
Additional Information
| SKU | 10289506 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23605 |
