Ap3b2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ap3b2, Each
$ 1,757.70
|
|
Details
Adaptor protein-3 (ap3) is a heterotetrameric vesicle-coat protein complex. Some ap3 subunits are ubiquitously expressed, whereas others are expressed exclusively in neurons. The neuron-specific ap3 complex, which includes ap3b2, is thought to serve neuron-specific functions such as neurotransmitter release (grabner et al., 2006 [Pubmed 16788073]).[Supplied by omimsequence: apvfmsenefkkeqgklmgmneiteklmlpdtcrsdhivvqkvtatanlgrvpcgtsdeyrfagrtltggslvlltldarpagaaqltvnsekmvigtmlvkdviq
Additional Information
| SKU | 10289455 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23545 |
