518-831-8000 sales@utechproducts.com

Ap1gbp1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ap1gbp1, Each

1,757.70

Details

This gene encodes a protein that interacts with the gamma subunit of ap1 clathrin-adaptor complex. The ap1 complex is located at the trans-golgi network and associates specific proteins with clathrin-coated vesicles. This encoded protein may act to connect the ap1 complex to other proteins. Alternatively spliced transcript variants that encode different isoforms have been described for this gene. [Provided by refseqsequence: qqqgfpmvsvmqpnmqgimgmnyssqmsqgpiamqagipmgpmpaagmpylgqapflgmrppgpqytpdmqkqfaeeqqkrfeqqqklleeerkrrqfeeqkqklrllssvkp

Additional Information

SKU 10287769
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21587