Amtn, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Amtn, Each
$ 1,757.70
|
|
Details
The mineralized portions of teeth, the dentin and enamel, are formed by mesenchyme-derived odontoblasts and epithelium-derived ameloblasts, respectively. As ameloblasts differentiate, they deposit specific proteins necessary for enamel formation, including amelogenin (amelx; mim 300391), enamelin (enam; mim 606585), and ameloblastin (ambn; mim 601259), in the organic enamel matrix. Amelotin is specifically expressed in maturation-stage ameloblasts (iwasaki et al., 2005 [Pubmed 16304441]).[Supplied by omimsequence: slpqlkpalglpptklapdqgtlpnqqqsnqvfpslslipltqmltlgpdlhllnpaagmtpgtqthpltlgglnvqqqlhphvlpifvtqlgaq
Additional Information
| SKU | 10288940 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22952 |
