Alg3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Alg3, Each
$ 1,757.70
|
|
Details
This gene encodes a member of the alg3 family. The encoded protein catalyses the addition of the first dol-p-man derived mannose in an alpha 1,3 linkage to man5glcnac2-pp-dol. Defects in this gene have been associated with congenital disorder of glycosylation type id (cdg-id) characterized by abnormal n-glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: idwkaymaevegvingtydytqlqgdtgplvypagfvyifmglyyatsrgtdir
Additional Information
| SKU | 10290067 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24386 |
