Akap3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Akap3, Each
|
|
Details
The a-kinase anchor proteins (akaps) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase a (pka) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the akap family, and is expressed in testis only. The encoded protein contains an rii-binding domain, and is predicted to participate in protein-protein interactions with the r-subunit of the pka. This protein is localized to the ribs of the fibrous sheath in the principal piece of the sperm tail. It may function as a regulator of both motility- and head-associated functions such as capacitation and the acrosome reaction. [Provided by refseqsequence: aqggrrdarsfveaagttnfpaneppvapdesclksapivgdqeqaekkdlrsvffnfirnllsetifkrdqspepkvpeqpvkedrklcerp
Additional Information
| SKU | 10289483 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23578 |
