Agps Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Agps, Each
$ 1,757.70
|
|
Details
This gene is a member of the fad-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (dhap) is converted to alkyl-dhap by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires fad as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and zellweger syndrome. [Provided by refseqsequence: keritreckekgvqfapfstcrvtqtydagaciyfyfafnyrgisdpltvfeqteaaareeilanggslshhhgvgklrkqwlkesisdvgfgmlks
Additional Information
| SKU | 10288480 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22416 |
