518-831-8000 sales@utechproducts.com

Agpat9, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Agpat9, Each

1,757.70

Details

Glycerol-3-phosphate (g3p) acyltransferases (gpat; ec 2.3.1.15), Such as gpam (mim 602395) and gpat3, catalyze the initial step of de novo triacylglycerol (tag) synthesis by converting glycerol-3-phosphate (g3p) to lysophosphatidic acid (lpa) (cao et al., 2006 [Pubmed 17170135]).[Supplied by omimsequence: ilvktlewatiriekgtpkesilknsasvgiiqrdespmekglsglrgrdfelsdvfyfskkgleaivedevtqrfsseelvswnlltrtn

Additional Information

SKU 10288373
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22285