Agpat9, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Agpat9, Each
$ 1,757.70
|
|
Details
Glycerol-3-phosphate (g3p) acyltransferases (gpat; ec 2.3.1.15), Such as gpam (mim 602395) and gpat3, catalyze the initial step of de novo triacylglycerol (tag) synthesis by converting glycerol-3-phosphate (g3p) to lysophosphatidic acid (lpa) (cao et al., 2006 [Pubmed 17170135]).[Supplied by omimsequence: ilvktlewatiriekgtpkesilknsasvgiiqrdespmekglsglrgrdfelsdvfyfskkgleaivedevtqrfsseelvswnlltrtn
Additional Information
| SKU | 10288373 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22285 |
