Ado Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ado, Each
$ 1,757.70
|
|
Details
Human thiol dioxygenases include cysteine dioxygenase (cdo; mim 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ado; ec 1.13.11.19). Cdo adds 2 oxygen atoms to free cysteine, whereas ado adds 2 oxygen atoms to free cysteamine to form hypotaurine (dominy et al., 2007 [Pubmed 17581819]).[Supplied by omimsequence: pnlppvtymhiyetdgfslgvfllksgtsiplhdhpgmhgmlkvlygtvriscmdkldag
Additional Information
| SKU | 10289433 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23522 |
