Adat1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Adat1, Each
$ 1,757.70
|
|
Details
This gene is a member of the adar (adenosine deaminase acting on rna) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mrna editing of nuclear transcripts. The protein encoded by this gene, trna-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic trna. [Provided by refseqsequence: iaqlcyehygirlpkkgkpepnhewtllaavvkiqspadkacdtpdkpvqvtkevvsmgtgtkcigqskmrkngdilndshaeviarrsfqr
Additional Information
| SKU | 10289578 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23683 |
