Abl1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abl1, Each
|
|
Details
The abl1 protooncogene encodes a cytoplasmic and nuclear protein tyrosine kinase that has been implicated in processes of cell differentiation, cell division, cell adhesion, and stress response. Activity of c-abl protein is negatively regulated by its sh3 domain, and deletion of the sh3 domain turns abl1 into an oncogene. The t(9;22) translocation results in the head-to-tail fusion of the bcr (mim:151410) and abl1 genes present in many cases of chronic myelogeneous leukemia. The dna-binding activity of the ubiquitously expressed abl1 tyrosine kinase is regulated by cdc2-mediated phosphorylation, suggesting a cell cycle function for abl1. The abl1 gene is expressed as either a 6- or 7kb mrna transcript, with alternatively spliced first exons spliced to the common exons 2-11. [Provided by refseqsequence: ptppkrsssfremdgqperrgageeegrdisngalaftpldtadpakspkpsngagvpngalresggsgfrsphlwkksstlt
Additional Information
| SKU | 10288252 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22144 |
