Abcc4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abcc4, Each
|
|
Details
The protein encoded by this gene is a member of the superfamily of atp-binding cassette (abc) transporters. Abc proteins transport various molecules across extra- and intra-cellular membranes. Abc genes are divided into seven distinct subfamilies (abc1, mdr/tap, mrp, ald, oabp, gcn20, white). This protein is a member of the mrp subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in cellular detoxification as a pump for its substrate, organic anions. Alternative splicing results in multiple splice variants encoding different isoforms. [Provided by refseqsequence: nfsvgqrqlvclarailrknqiliideatanvdprtdeliqkkirekfahctvltiahrlntiidsdkimvldsgrlkeydepyvllqnkeslfykmvqqlgkaeaaaltetakqvyfkrnyphightdhmvtntsngqpst
Additional Information
| SKU | 10292509 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28670 |
