518-831-8000 sales@utechproducts.com

Abcb8, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abcb8, Each

1,757.70

Details

The membrane-associated protein encoded by this gene is a member of the superfamily of atp-binding cassette (abc) transporters. Abc proteins transport various molecules across extra- and intra-cellular membranes. Abc genes are divided into seven distinct subfamilies (abc1, mdr/tap, mrp, ald, oabp, gcn20, white). This protein is a member of the mdr/tap subfamily. Members of the mdr/tap subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, it may involve the compartmentalization and transport of heme, as well as peptides, from the mitochondria to the nucleus and cytosol. This protein may also play a role in the transport of phospholipids into mitochondrial membranes. [Provided by refseqsequence: lfrvgirggpfpgrllpplrfqtfsavrysdgyrsssllravahlrsqlwahlpraplaprwspsawcwvggallgpmvlskhphlclvalceaeeappasstphvvgsrfnwklfwqfl

Additional Information

SKU 10290072
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24392